PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 387aa    MW: 43360.4 Da    PI: 7.4478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602508.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l+d++k  G g W+  +++ g++R++k+c++rw++yl
   XP_009602508.1 14 KGAWTPMEDKILIDYIKVNGEGKWRNLPKRAGLKRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.91.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++k+lG++ W++Ia +++ gRt++++k++w++
   XP_009602508.1  67 RGNITPDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                      7999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.63961IPR017930Myb domain
SuperFamilySSF466894.3E-2812108IPR009057Homeodomain-like
SMARTSM007176.2E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-141461IPR001005SANT/Myb domain
CDDcd001672.86E-101661No hitNo description
PROSITE profilePS5129425.00262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2465116IPR009057Homeodomain-like
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PfamPF002498.4E-1567110IPR001005SANT/Myb domain
CDDcd001675.61E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGRKPCCSKE GLNKGAWTPM EDKILIDYIK VNGEGKWRNL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TPDEEDLIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NIGKKLQQGV  120
APGQPNRIIS SINRQRPRSS HAKSSKSDPV TQPNKNNQEH TVPNQDSHYL LTDVGFGGSS  180
SSSSPCLVIR TKAIRCTKVF ITPPPTSSSV AEPQNVDQSH NEIAQRASNS HSVFPPCTRN  240
PVEFLRFHVD NSILDNDNDD KVMAEDLTIE NANTIVASSS SSSSLSVSSL SEQQQPISGS  300
KPTFYGELEN YNFNFMFGFD MDDPFLSELL NAPDICENLE NTTTVGDSCS KNEKERSYFP  360
SNYSQTTLFA EDTQHNDLEL WINGFSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121165108B-MYB
1h8a_C4e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2541974e-49AC254197.3 Solanum lycopersicum strain Heinz 1706 chromosome 12 clone sle-22m10 map 12, complete sequence.
GenBankHG9755244e-49HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602508.10.0PREDICTED: myb-related protein 330-like
TrEMBLK4DFL01e-152K4DFL0_SOLLC; Uncharacterized protein
STRINGSolyc12g049300.1.11e-152(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-62myb domain protein 3